Protein Info for BBR_RS13705 in Bifidobacterium breve UCC2003

Annotation: Conserved hypothetical membrane spanning protein, contains a vitamin K epoxide reductase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 215 to 238 (24 residues), see Phobius details PF07884: VKOR" amino acids 35 to 169 (135 residues), 110.9 bits, see alignment E=2.7e-36

Best Hits

KEGG orthology group: None (inferred from 89% identity to bln:Blon_0770)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>BBR_RS13705 Conserved hypothetical membrane spanning protein, contains a vitamin K epoxide reductase domain (Bifidobacterium breve UCC2003)
MTHTNSTNGARNDTSTASIPRLTGWRHSATWTYLIMLIASAVALGASFILSAETLQLARH
PESSLGCDVNAVVSCSTVAQSWQAELVKFGGLSYPNAFFGIAAESVFITIAVIGMARVRV
PRWFATCTWFGGLAALAYSYWLSTQSLFVIHALCPWCLTLMFSTTIQFMALSHATVAVQG
LPSRKVTDEENGIAPDMPQIPAGLNKYYRLNIDLMVDVLWIVAIVVLIIVTEGAALFAA