Protein Info for BBR_RS13670 in Bifidobacterium breve UCC2003
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to MEGL_PSEDM: L-methionine gamma-lyase (megL) from Pseudomonas deceptionensis
KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 98% identity to blo:BL0078)MetaCyc: 46% identical to methionine gamma-lyase (Pseudomonas deceptionensis)
Methionine gamma-lyase. [EC: 4.4.1.11]
Predicted SEED Role
"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-threonine degradation I (6/6 steps found)
- L-cysteine degradation II (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
- homocysteine and cysteine interconversion (3/4 steps found)
- superpathway of L-threonine metabolism (13/18 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (5/7 steps found)
- D-serine degradation (2/3 steps found)
- L-methionine degradation II (2/3 steps found)
- L-tryptophan degradation II (via pyruvate) (2/3 steps found)
- hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (4/6 steps found)
- dimethyl sulfide biosynthesis from methionine (1/2 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (3/5 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glycine betaine degradation III (3/7 steps found)
- glycine betaine degradation I (3/8 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (4/10 steps found)
- glutathione-mediated detoxification I (2/8 steps found)
- superpathway of L-methionine salvage and degradation (5/16 steps found)
- hypoglycin biosynthesis (3/14 steps found)
- purine nucleobases degradation II (anaerobic) (8/24 steps found)
- superpathway of seleno-compound metabolism (4/19 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Methionine metabolism
- Nitrogen metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.4.1.8
Use Curated BLAST to search for 4.4.1.1 or 4.4.1.11 or 4.4.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-positive bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (410 amino acids)
>BBR_RS13670 hypothetical protein (Bifidobacterium breve UCC2003) MTRFNTQLVHGLPVGDNNTGAVNPPIYNSTTYAFERVDAMPRYDYARSGNPTRDFLEQQI AQLEQGTRGFAFASGLAAIHAVLSIFKPGDRIVVGDNIYGGSYSQLNEFFTRWGIIVEAV DTQDIAVLEAAVKGDRANGIAPAQAVYFETLTNPLLKVNDVRAISTVAHRFGALSIVDNT FVTPYLQKPLALGADVVIHSATKYLAGHSDVNAGLVVVSGEDLANRVYFAQNRLGGVLAP AECDAVRRGIQTLALRMDRQQENANAIACYLLVHPLVKSVHYPGLPGAGDQHLAAKGLKG AGGVLSFEVVPGVDPADVLNNLHLFRLAVSLGAVESLAELPCRMTHFELPREERLKIGIT DELVRLAVGIEDANDLIEDLGQAFDTAYARYIDRHADTDVFQQLTSGVFA