Protein Info for BBR_RS13665 in Bifidobacterium breve UCC2003

Annotation: phospholipase/carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF02230: Abhydrolase_2" amino acids 14 to 207 (194 residues), 72.8 bits, see alignment E=5.6e-24 PF00756: Esterase" amino acids 67 to 151 (85 residues), 23.1 bits, see alignment E=8.2e-09 PF01738: DLH" amino acids 87 to 197 (111 residues), 22.4 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: K06999, (no description) (inferred from 87% identity to blf:BLIF_1418)

Predicted SEED Role

"possible phospholipase/carboxylesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>BBR_RS13665 phospholipase/carboxylesterase (Bifidobacterium breve UCC2003)
MEITKALTRLKGLENDPVFMLLHGWGSNEYDLPDLLNYCGAGSADYASLQAPIAYGMGYT
WFGSWAHEGVPEGKSLDEQALAAAQAIDAWVGANIPATRPIVMMGFSQGGLLATHILRFN
PNRYAAAVSCSGWLAPGTVDGDAQLASLRPPVFYGHGAIDDIFPKADVAAMGTFWREHGT
LTEEVYPGMAHSINMPEMRDIQRFLEKNGFIRPQIW