Protein Info for BBR_RS13630 in Bifidobacterium breve UCC2003

Annotation: carbamoyl-phosphate synthase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01368: carbamoyl-phosphate synthase, small subunit
  • amino acids 19 to 400 (382 residues), 434 bits, E=2.1e-134
• PF00988: CPSase_sm_chain
  • amino acids 21 to 146 (126 residues), 166.1 bits, E=4.8e-53
• PF00117: GATase
  • amino acids 211 to 397 (187 residues), 143.6 bits, E=9e-46
• PF07722: Peptidase_C26
  • amino acids 258 to 380 (123 residues), 23.4 bits, E=7.1e-09

Best Hits

Swiss-Prot: 98% identical to CARA_BIFLO: Carbamoyl-phosphate synthase small chain (carA) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01956, carbamoyl-phosphate synthase small subunit [EC: 6.3.5.5] (inferred from 97% identity to bll:BLJ_1406)

Predicted SEED Role

"Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)" in subsystem De Novo Pyrimidine Synthesis or Macromolecular synthesis operon (EC 6.3.5.5)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• UMP biosynthesis I (5/6 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• superpathway of arginine and polyamine biosynthesis (8/17 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Glutamate metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.5

Use Curated BLAST to search for 6.3.5.5

Protein Sequence (407 amino acids)

>BBR_RS13630 carbamoyl-phosphate synthase small subunit (Bifidobacterium breve UCC2003)
MSQNESGTIAIPMYDKDDAVLVLEDGQVYVGEPYGALGETTGEIVFATGMTGYQETLTDP
SYDRQIVVQTFPHIGDTGVNSEDPESSRIWVAGYIVRDPSPNVSNWRAEGSLDDDLVKNG
IVGLSHIDTRKLVRHLRSAGVMRAGIFSGEALVDAATGKLKTIEQLLEDVKNTPPMQGLS
LYDEVSTKETYTIEPCGEYEGKEPLYTVAAVDLGIKGMTPHRMAERGCRVHVVPSTITFA
ELEALNPDGVFFSNGPGDPEQAGPEIELLRQVLDAGYPFFGICFGNQLLGRALGFGTYKL
KFGHRGINQPVKDLTTGKVEVTAHNHGFAVDAPIGKQVDAPFENGKYGKVFVSHIDLNDD
VVEGLQCVDIPAFSVQYHPEAAAGPHDAAYLFDRFCELMKNNPKEGK