Protein Info for BBR_RS13625 in Bifidobacterium breve UCC2003

Annotation: transcription antitermination factor NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01951: transcription antitermination factor NusB
  • amino acids 3 to 130 (128 residues), 119.8 bits, E=4.8e-39
• PF01029: NusB
  • amino acids 5 to 128 (124 residues), 98.6 bits, E=1.9e-32

Best Hits

Swiss-Prot: 80% identical to NUSB_BIFLS: Transcription antitermination protein NusB (nusB) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 80% identity to bln:Blon_0736)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Protein Sequence (176 amino acids)

>BBR_RS13625 transcription antitermination factor NusB (Bifidobacterium breve UCC2003)
MARSTARKRALNTLYEADEKGQDILSLLDERIAHPGAQTPLPDYAIDIVKGVAEHRRQID
MTLDDHSTGWKVRRMGVVDRNILRIAAWEILFNDEVPDKVAIDEALALAKTLCDDDSPAF
IHGLLSAVCNAKNTEPAGSVDDEPAEESNEPDQSGQTDFPASEPADPSAETQPTVD