Protein Info for BBR_RS13610 in Bifidobacterium breve UCC2003

Annotation: iron export ABC transporter permease subunit FetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details TIGR00245: TIGR00245 family protein" amino acids 9 to 255 (247 residues), 166.2 bits, see alignment E=4.6e-53 PF03649: UPF0014" amino acids 10 to 250 (241 residues), 227.8 bits, see alignment E=6.5e-72

Best Hits

Swiss-Prot: 32% identical to Y1647_SYNY3: UPF0014 membrane protein slr1647 (slr1647) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02069, putative ABC transport system permease protein (inferred from 96% identity to bll:BLJ_1410)

Predicted SEED Role

"YbbM seven transmembrane helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>BBR_RS13610 iron export ABC transporter permease subunit FetB (Bifidobacterium breve UCC2003)
MNGAYDIDVWGLVLALGMVAAAAIISELMHMGIGRTLMWSACRALVQLCAMGFIISYVIR
SNSVWMVFALMAVMLIAAVQIVMSRAHGIPKGLAGPIFLSLVITMLLMLALVTELIVRPH
PWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESMEERRDEVDMMLALGATAWESARPSVI
SSIRLGLLPTTASLASSGIVTIPGMMAGQVIAGGDPLNAAKYQFVVFGAIAALTLLADGL
IMAMVYRTCFTADDQYQPPKAR