Protein Info for BBR_RS13605 in Bifidobacterium breve UCC2003

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 817 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 127 to 127 (1 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 380 to 528 (149 residues), 41 bits, see alignment E=8.2e-15 PF00990: GGDEF" amino acids 383 to 529 (147 residues), 56.3 bits, see alignment E=3.6e-19 PF00563: EAL" amino acids 559 to 790 (232 residues), 100.8 bits, see alignment E=8e-33

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (817 amino acids)

>BBR_RS13605 GGDEF domain-containing protein (Bifidobacterium breve UCC2003)
MASKQSKHQATTGSQSKDGIGKPVRLTILAIIYTLFLAAAIAFHAQEGVQRLMEGPARIC
IWSLCFLLCLVYHKKRSSYRVAAEHTVLPPLTVILLVTGYFPDVAMFLIIVTIITSIITA
RSLKIGILRAGTTLVPIPLIKILFVNTSHVLSITINQHSVNAAFNPYQFQNWLLPLLIMT
VAVPIVRLICDIVTFFFAQIPIRKAMHEYSLSHILAMALADLLAIVWIPEILEFANIGSD
TATVLSVFMLALIAYSLLLMTVDTMSRLARSRSALKCIANVSDALPLPNQVPEETVVRRI
NRGLTRMRCFVSDANNLDKRGYSYRYSAPISTGSRQYYLAMERSIWNRPFTSTDETILLT
CGEVLTESLRVNKEVTLLRTESETDALTGALTYRAFIGHLKSLQTENVHNLVAVVYFGVE
HLRTVNEHYGRKIGNAVLRSVGMRLSQLPDNATLSRVNGAEFAMLVTDVTSTSDVEELAT
RMRNLAVMPVHTEEGEVSVDVSSSISFSNATDGFAVLLADASAHIYESESSNLPAVDGTT
ATLAAQNGSDDYVNVSDVLRHAIEDNTISVLYQPIFDVNTKRITSLDTIVRVHDAKGRTL
APYFVTAEAHRLNMSVQLTLDVLETCVKDMTAFRQVAPELDIVDICMNGSELGASIFHER
LEQLTHEQPQLRFGLQLGSHAIHVAHDEVDDEVADLVALPNVKLGLTNVGTTYSEVAAFA
HLPLDFARFDKTVVRDFRTPRAKQIMQRTLDISRDNDAFHVVFDGVETLDQVEFIRSIGG
TLAEGTLLSNAMNANEFLMRLETMGTSLPEAAPRQAE