Protein Info for BBR_RS13575 in Bifidobacterium breve UCC2003

Annotation: sugar O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF12464: Mac" amino acids 24 to 75 (52 residues), 25.5 bits, see alignment E=1.9e-09 PF14602: Hexapep_2" amino acids 147 to 182 (36 residues), 43 bits, see alignment 4.4e-15 PF00132: Hexapep" amino acids 148 to 182 (35 residues), 48.9 bits, see alignment 4.7e-17

Best Hits

Swiss-Prot: 49% identical to THGA_ECOLI: Galactoside O-acetyltransferase (lacA) from Escherichia coli (strain K12)

KEGG orthology group: K00633, galactoside O-acetyltransferase [EC: 2.3.1.18] (inferred from 98% identity to blj:BLD_0832)

MetaCyc: 49% identical to galactoside O-acetyltransferase (Escherichia coli K-12 substr. MG1655)
Galactoside O-acetyltransferase. [EC: 2.3.1.18]

Predicted SEED Role

"Galactoside O-acetyltransferase (EC 2.3.1.18)" in subsystem Lactose utilization (EC 2.3.1.18)

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.18

Use Curated BLAST to search for 2.3.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>BBR_RS13575 sugar O-acetyltransferase (Bifidobacterium breve UCC2003)
MMTEDKPIAKPIIDDATREKMALMFSGEVYLPDDVDGFFDLQAAQRDLQLELNATPLTNP
KRRTELMQVFFGAAGEGLYLECPVYANWGCNTYWGERCYANFNLTLVDDGEIFIGSHTMI
GPNVTLVATGHPVRPDLRYQGAQYSLPVHIGENVWIGANVTVLPGATIGDNAVIGANSLV
TKDIPANTVAYGSPCKVIREINERDDVYYWRDRQFSERFRVEEQ