Protein Info for BBR_RS13560 in Bifidobacterium breve UCC2003

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 397 to 421 (25 residues), see Phobius details amino acids 428 to 447 (20 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 34 to 420 (387 residues), 189.5 bits, see alignment E=4.6e-60 PF01554: MatE" amino acids 34 to 194 (161 residues), 79.5 bits, see alignment E=1.2e-26 amino acids 265 to 408 (144 residues), 69.6 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 97% identity to blf:BLIF_0549)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>BBR_RS13560 MATE family efflux transporter (Bifidobacterium breve UCC2003)
MVQVHGMRRASADAKYQQMTGQPVKPLILKLCLPAVISNLVTTAYNLTDTFFIGQLGTAQ
SGAIGIAFSIMTVMQALGFFFGNGAGNSMSRELGKQNNERASRLLAVGFAGAVISGLVIA
AIGLLILRPLVVMLGSTSTIAPYAVQYLTPLLVAAPCVCGSFALNGLLRYQGQSAFGMIG
LVSGALLNFLLAPLFIFVAGLGIFGAGLATAICQTVSFAILTTMSRKFGVMKLSLRNCKP
DVLLMREVAGGGLPSLIRQGAGSISVTCVNIAANPFGDAAIAGMAIVMRIMLGANSVIVG
LGQGFQPVCGYNYGAGLFARVKEGYWFCVRLATCVLVALAVLLWVFAPQLVEIFRSDPAV
VAVGVAALHIQCCTVILNGFNMMGNMMTQTMGRTGIASFLALCRQGLFLAPIVLILPMTF
GVLGVEMAQSVSDVLTFLVTIPFMRRILHELR