Protein Info for BBR_RS13540 in Bifidobacterium breve UCC2003

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF08240: ADH_N" amino acids 30 to 126 (97 residues), 81 bits, see alignment E=5.5e-27 PF00107: ADH_zinc_N" amino acids 180 to 288 (109 residues), 82.5 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: K00001, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 95% identity to blm:BLLJ_0522)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>BBR_RS13540 alcohol dehydrogenase (Bifidobacterium breve UCC2003)
MTEMMKAAIFVEPGKMAVEEVPKATLEQDDDIVIRVVRTCVCGSDLWFFRGLSGQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAASAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPERDQAAIDKVLGMTDGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIGF