Protein Info for BBR_RS13530 in Bifidobacterium breve UCC2003

Annotation: CrcB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details PF02537: CRCB" amino acids 33 to 147 (115 residues), 65.1 bits, see alignment E=3.2e-22

Best Hits

Swiss-Prot: 97% identical to CRCB2_BIFLO: Putative fluoride ion transporter CrcB 2 (crcB2) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K06199, CrcB protein (inferred from 97% identity to blf:BLIF_0540)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>BBR_RS13530 CrcB family protein (Bifidobacterium breve UCC2003)
MGSQSPSAGARPITHTTTPPACKLPDIHLDIVLVVFCGGTIGTAIRYAFAQIPAAGSFHT
GTFVANMLACFCYAGLTAYLTGASRFGARSKELASRGLGMGVCGGLSTMSTLALEGFTAI
RDGQVAAGIAYLLVTFALGLVCASAGVWAGTHLAGPSNVSAEASADTNAATTSKGGKA