Protein Info for BBR_RS13525 in Bifidobacterium breve UCC2003

Annotation: CrcB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details PF02537: CRCB" amino acids 7 to 119 (113 residues), 86.9 bits, see alignment E=5.5e-29

Best Hits

Swiss-Prot: 98% identical to CRCB3_BIFLO: Putative fluoride ion transporter CrcB 3 (crcB3) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K06199, CrcB protein (inferred from 97% identity to blb:BBMN68_840)

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>BBR_RS13525 CrcB family protein (Bifidobacterium breve UCC2003)
MTVFLPILVCLCGGVGASCRYLLDVTIKTYWRRAFPLSTFTINLIAGFLAGLVAALALGG
TLDEPWRLVLATGFLGGFSTFSTAINEMVTLFCKHRYPTAAAYLVLSLSVPVVAAACGFL
V