Protein Info for BBR_RS13515 in Bifidobacterium breve UCC2003

Annotation: putative sulfate exporter family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 22 to 334 (313 residues), 212.2 bits, see alignment E=4.3e-67

Best Hits

Swiss-Prot: 98% identical to Y1094_BIFLO: UPF0324 membrane protein BL1094 (BL1094) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: None (inferred from 100% identity to bln:Blon_1920)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>BBR_RS13515 putative sulfate exporter family transporter (Bifidobacterium breve UCC2003)
MREFCTKWWKRIAAVDMLFIGVLTLLASLFASWLKQFPGFSLFGALIIALLIGMIIQFPI
RSAYVGSNDGRKAGVKDAAGLISNKLLRLGIILLGFKLNLAVLFTQGIKCLPIAAVVVTL
TIIVCYAIARKLGVDPMLAILTAGGTGICGAAAVMGLAGSIKVSEDKQDEKDNDVTMAVA
IVAIMGTVFALLEIALGPLTGMTKDQLGITAGASLHEIAHAVAAGDAFGAVDIATIMKLS
RVLMLVFAAIIIAIWWEKKHSEVENTGKKTVAFPWFMLGFIGASIIGTFVPFIAFITPQL
VDFAYIVLGMAMAALGINVNFKAIASKGKKPMLASFLTSILLMCFAAGVAVLFF