Protein Info for BBR_RS13480 in Bifidobacterium breve UCC2003

Annotation: bile acid:sodium symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details PF13593: SBF_like" amino acids 14 to 312 (299 residues), 75.4 bits, see alignment E=5.3e-25 PF01758: SBF" amino acids 43 to 215 (173 residues), 135.7 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 44% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 95% identity to blm:BLLJ_0511)

Predicted SEED Role

"COG0385 sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>BBR_RS13480 bile acid:sodium symporter family protein (Bifidobacterium breve UCC2003)
MEKVKAFADWLTKWFTVIVIVWAVFNYFVPAASLWGKAYTGYMLGIVLFGMGLTLTLDDF
KRILTQPLMVIVGTIAHFIIMPLIAVALCAIFHLSGPLAVGVILVGCCPSGTSSNVMSYL
SRGDVALDVSIGILSTLCAPFMIPLLMQLLASQYVSVPVESLFLNAVKVVLFPIALGVIC
HMIFGKKIEKITVALPIVSQVAILLIIGVVVAANGPKLFVASSLMAIPVVILHNLCGYSL
GFGFSKLMYKIYPKGFRYAQQKAITFEVGMQDSALGETLALTSFASNPIAAVPSTFFSVW
HNISGSILSSWWRNHDDKHEIHWDSDNGEKGSAKNVATGDHPFDADKKATADAKVEG