Protein Info for BBR_RS13465 in Bifidobacterium breve UCC2003

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13439: Glyco_transf_4" amino acids 28 to 190 (163 residues), 70.6 bits, see alignment E=3.5e-23 PF13579: Glyco_trans_4_4" amino acids 29 to 189 (161 residues), 68.2 bits, see alignment E=2.2e-22 PF00534: Glycos_transf_1" amino acids 210 to 358 (149 residues), 70 bits, see alignment E=3.7e-23 PF13692: Glyco_trans_1_4" amino acids 211 to 346 (136 residues), 49.6 bits, see alignment E=1e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to bln:Blon_1936)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>BBR_RS13465 glycosyl transferase (Bifidobacterium breve UCC2003)
MRENGIEKSIDRPLTIALVVDTVGNQGNGTSNSALQWAAELERQGHHVRLVGVGAPEYPA
RVNKVPLVSWVAAKQLMQFAEPSDTLFRTAFQGVDVVHVYMPFKFGRRAAKVAHQMGIPV
TAGFHLQPENVLYSAGPLRHIPGISSFLYWLFKHWLYKRIDHIHVPTEMTASLLRAHGYK
AKLHVISNGYSPVYSPKKPVDPEASAPVPFRVIASGRLASEKDQITLIKAASMSKHAGGI
QLIIAGTGPLKQYLRFRAGRLLARKADIGFHKHADMPDLLRSGDLFVHCSIADIESVSVI
EAMACGLVPVIAASELSAASQFALLDESLFPVQNAAMLARRIDWWIEHQVERAEWGEKYA
EYTKAHYSVEASVHKFVDMEREAIGE