Protein Info for BBR_RS13455 in Bifidobacterium breve UCC2003

Annotation: formate-dependent phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02222: ATP-grasp
  • amino acids 143 to 328 (186 residues), 149.8 bits, E=1.2e-47
• PF02786: CPSase_L_D2
  • amino acids 143 to 208 (66 residues), 21.7 bits, E=2.6e-08
• PF07478: Dala_Dala_lig_C
  • amino acids 164 to 320 (157 residues), 26.3 bits, E=9.8e-10
• PF21244: PurT_C
  • amino acids 361 to 427 (67 residues), 60.9 bits, E=1.4e-20

Best Hits

Swiss-Prot: 94% identical to PURT_BIFLO: Formate-dependent phosphoribosylglycinamide formyltransferase (purT) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 92% identity to bln:Blon_1938)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (9/12 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• One carbon pool by folate
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2

Protein Sequence (433 amino acids)

>BBR_RS13455 formate-dependent phosphoribosylglycinamide formyltransferase (Bifidobacterium breve UCC2003)
MTENAVNTAVTSPSPAIPAVNRPLGTPLGKHPTRVLFLGAGELGKEVAIELMRLGAWVCA
ADSYAGAPAQQVAHEYRVLDMANAAELQVLFDEVKPDIIVPEVEAIATDMLAGAAAAGAQ
VVPSAEIAAICMDRERLRVLAHEELGLPTTPYRFAGSLEELRAGALEVGYPCVVKPLMSS
SGHGQSVVRSANAIDAAWTEAQEGRRAADEGDVSRVIVEALAPLERELTVLTVSSSAGIV
TCAPIGQRQESGDYRESWQPAAEPGGESERAQDIARTVVEGLVAKAQAAGETGWGVFGVE
LFVLTDGSILFNEVSPRPHDTGMVTMASQRLSEFALHARAILGLPITAEHVALTIPSGSV
AASHAIVVAGDGEAEFTDVAAALAEPSTDLRIFAKPEVHGHRRMAVALAVGESEADARAK
AAHVADALTITVK