Protein Info for BBR_RS13380 in Bifidobacterium breve UCC2003

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR01134: amidophosphoribosyltransferase" amino acids 12 to 458 (447 residues), 523.7 bits, see alignment E=2.7e-161 PF13230: GATase_4" amino acids 72 to 156 (85 residues), 28.3 bits, see alignment E=2e-10 PF13522: GATase_6" amino acids 74 to 206 (133 residues), 66.6 bits, see alignment E=6e-22 PF13537: GATase_7" amino acids 92 to 210 (119 residues), 70.8 bits, see alignment E=2.5e-23 PF00310: GATase_2" amino acids 167 to 240 (74 residues), 23.4 bits, see alignment E=5.9e-09 PF00156: Pribosyltran" amino acids 285 to 382 (98 residues), 33.6 bits, see alignment E=5.9e-12

Best Hits

Swiss-Prot: 66% identical to PUR1_STAAN: Amidophosphoribosyltransferase (purF) from Staphylococcus aureus (strain N315)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 95% identity to bln:Blon_1958)

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>BBR_RS13380 amidophosphoribosyltransferase (Bifidobacterium breve UCC2003)
MSAELEDIHEECGIFGVWGHPDAARLTYFGLHALQHRGQEGAGIVSNDHGHLTGHRGLGL
LTQVFSDEREIERLKGDRAIGHVRYATAGSGTTDNIQPFIFRFHDGDVALCHNGNLTNCP
SLRRKLEDEGAIFHSNSDTEVLMHLIRRSLQRTFMDKLKEALNTVHGGFAYLLMTENAMI
GALDPNGFRPLSLGKMKNGAYVLASETCALDVVGAELVRDIRPGEIVVVDDHGYKIVQYT
NNTQLAICSMEYIYFARPDSNIYGINVHSARKRMGARLAQESPVDADMVIGVPNSSLSAA
SGYAEAAGLPNEMGLIKNQYVARTFIQPTQELREQGVRMKLSAVRGVVKGKRVIVIDDSI
VRGTTSRRIVQLLKEAGAAEVHMRISSPPLKYPCFYGIDISTTKELIAAKMSVEEIRDYI
GADSLAYLSLDGLVESIGLNADAPYGGLCVAYFNGDYPTALDDYEADFLKSLTPEDRVRL
PEFALYKSKYVGNEYNTVQPDAQ