Protein Info for BBR_RS13370 in Bifidobacterium breve UCC2003

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR00877: phosphoribosylamine--glycine ligase" amino acids 4 to 421 (418 residues), 502.5 bits, see alignment E=4.7e-155 PF02844: GARS_N" amino acids 4 to 103 (100 residues), 109 bits, see alignment E=3.7e-35 PF01071: GARS_A" amino acids 104 to 296 (193 residues), 274.7 bits, see alignment E=9.4e-86 PF02786: CPSase_L_D2" amino acids 106 to 193 (88 residues), 21.7 bits, see alignment E=2.7e-08 PF02843: GARS_C" amino acids 331 to 419 (89 residues), 81.7 bits, see alignment E=8e-27

Best Hits

Swiss-Prot: 56% identical to PUR2_STRP6: Phosphoribosylamine--glycine ligase (purD) from Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 97% identity to blj:BLD_0880)

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>BBR_RS13370 phosphoribosylamine--glycine ligase (Bifidobacterium breve UCC2003)
MGQKVLVIGSGAREHTIAYTLLKAPSVDEVTVAPGNPGMLKDGIHTTQLSQSNHAALIDF
VKDNDYDWVLVGPEVPLIEGIVNDFAAAGIKAFGPSKAAAQIEGSKDFAKQLMDRHNIPT
AQYKTFSDLELAQDYVHEHGAPIVIKADGLAAGKGVTVAMDELTAQRALEDIFIDHRFGS
AGAKVVIEDFLDGQEFSLMSFVNGTDFWPMPISQDHKRAHDGDEGPNTGGMGAYSPVPQI
PQSVVDEAIETIVRPTVEGMAEEGTPFTGILYAGLIATADGPKVIEFNARFGDPETEVVL
PKLTSDLGAGISAILDGETPEFTWNESNATLGVVIASNGYPENVIKGAHVPEIDVDEDSH
VYYAGVASDEHGNLVANSGRVLLVETSAPDIKSAQDKVYAIIDKFELRGMFYRHDIGFKA
LK