Protein Info for BBR_RS13340 in Bifidobacterium breve UCC2003

Annotation: TIGR03943 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details TIGR03943: TIGR03943 family protein" amino acids 29 to 244 (216 residues), 136.1 bits, see alignment E=5.7e-44 PF21537: DUF1980_C" amino acids 120 to 249 (130 residues), 87.4 bits, see alignment E=3.7e-29

Best Hits

KEGG orthology group: None (inferred from 97% identity to bln:Blon_1973)

Predicted SEED Role

"Membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>BBR_RS13340 TIGR03943 family protein (Bifidobacterium breve UCC2003)
MKRKVTLPDRVEALCFAALGAAIAYAAVGGSYTTLTTPRSLPYLIIGAVLLFVLATAAWL
GLFHATERSVLRFLIALIIPALLIAVPFQPSSGSGSFDEYAGGRAIVIPRSSHKPDGSSQ
LHGLDTANKTLTISDDEFGSWFEQIDHNPQRYVGYHVQVTGFVSKSRTFDADEFELSRQF
MSCCILDMTPFGFIASSGKAGTPHNHDWVTVDAVIKQGAYGSAGHERQGLILQVRSASKA
AAAPTGYFYWQ