Protein Info for BBR_RS13305 in Bifidobacterium breve UCC2003

Annotation: transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF01475: FUR" amino acids 7 to 120 (114 residues), 93.6 bits, see alignment E=5.1e-31

Best Hits

Swiss-Prot: 48% identical to ZUR_MYCTU: Zinc uptake regulation protein (zur) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 99% identity to blj:BLD_0885)

Predicted SEED Role

"Zinc uptake regulation protein ZUR" in subsystem Oxidative stress or Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>BBR_RS13305 transcriptional repressor (Bifidobacterium breve UCC2003)
MVEHIERQTKQKDAIRAALADCEEFISAQDLHRRLEDEGSKIGLATVYRQLNALADAGAA
DTIRLDGQQLFRLCGDDGHHHHLVCKRCGKTVEIDPPSEAWLRKVADGHGFTVESHTLEV
FGLCPDCQKEQKAQKAQKAVSE