Protein Info for BBR_RS13280 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 344 to 369 (26 residues), see Phobius details amino acids 399 to 422 (24 residues), see Phobius details amino acids 469 to 490 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 21 to 158 (138 residues), 47.4 bits, see alignment E=2.9e-16 PF02687: FtsX" amino acids 351 to 500 (150 residues), 56.9 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 83% identity to blb:BBMN68_881)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>BBR_RS13280 ABC transporter permease (Bifidobacterium breve UCC2003)
MRFSDILRLCRQNLWRRKSRTILTVLGVIVGCCSIVLMISLGQGINEQNEKMLKSMGDLS
IVTVYTSGGYAGPMGGGHGSSSASSDAKLDDKALESFRSMSGVSGATPIMNFPYNVTAKA
GAGGRYIYDHVQIMGIDMSQFEQMGYKMVDGSKPTTKDQVLAGEWFAYGFMDTLKNGEMR
TGTRGSGYSSCTFNSATGECEPDQDEDPFFDPLTTQISLTTGTNYQGDPYVQNMYGGGGG
TTVGSDQSDNVTIDLRASGIIGGDYNKGYATADGLVMDLQALKDLRAKVDPAAAKKTATY
DQVLVKAADLSSVPEVESQIKALGYETSSYEDMRKSLEEQSRAIQLILGGIGAVSLLVAA
IGIANTMVMSVTERTREIGIMKALGCYVRDIRVMFLTEAGAIGFFGGLIGCMLSGLISLG
INVAGRMYAGGMVGSSNGSSGEGAGGTSIWMIMWQALVGGEDVTRYSVIPWWLFLFAVLF
STLIGLLFGFGPANKAVKIPALDAIKNNE