Protein Info for BBR_RS13210 in Bifidobacterium breve UCC2003

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 80 to 110 (31 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 228 to 259 (32 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 369 to 391 (23 residues), see Phobius details PF03600: CitMHS" amino acids 14 to 324 (311 residues), 85.4 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: None (inferred from 89% identity to blf:BLIF_0489)

Predicted SEED Role

"possible transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>BBR_RS13210 anion transporter (Bifidobacterium breve UCC2003)
MRRWLVNVAKNETILVVAAILALISCFVVPPDDEYTMYIHASTISQLICLMIVVCGFQRI
GIFRIIGSRLLQRTSTMRGLVLTLVALTFFSAMLITNDVALVTFVPFAIAVLIMAGQEDK
TILVATLMTIGANVGSMLTPVGNAHNLYLKALTEMSTKRFISIMAPYSFTAAILLVIVIS
VVFGSKPVGDLGDLETGVLAPERSKHQPDEIRITGYGAGYGGWRTVVYSLLFIVCLLAVS
GIIPLWAMCVIVVVSFLFADRRVFKYVDWGLPLTFCMFFIFIGNMRRVPEFYELARTLVG
SHPLEVAVASSQVISNVPTTILLSSFCNQWRALIIGTNLGGMGTLIASMASLVAYKNVTR
QYPDKKGRYLAVYSAVNVLFLVVLLTLSWIIE