Protein Info for BBR_RS13180 in Bifidobacterium breve UCC2003

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 TIGR01391: DNA primase" amino acids 4 to 305 (302 residues), 294.3 bits, see alignment E=7.2e-92 PF01807: zf-CHC2" amino acids 6 to 101 (96 residues), 99.6 bits, see alignment E=2.1e-32 PF08275: DNAG_N" amino acids 129 to 257 (129 residues), 122.3 bits, see alignment E=4.3e-39 PF13662: Toprim_4" amino acids 265 to 351 (87 residues), 55.6 bits, see alignment E=1.5e-18 PF01751: Toprim" amino acids 266 to 350 (85 residues), 34.6 bits, see alignment E=5.2e-12 PF13155: Toprim_2" amino acids 267 to 348 (82 residues), 32.8 bits, see alignment E=2.2e-11 PF10410: DnaB_bind" amino acids 394 to 448 (55 residues), 47.1 bits, see alignment 6.9e-16

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 96% identity to bln:Blon_1995)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>BBR_RS13180 DNA primase (Bifidobacterium breve UCC2003)
MVGMIKKEDVEKVRAAADLYDIVSATVTLKPSGTGTFVGLCPFHDEKTGSFNVRPSLGVW
HCFGCGLGGDVFKYVEQSENIDFREAVELLADKYHIELHYENSGNGPNRENAGSKRTRLL
EACEEAQRFFVSQILTKEALPARKLLGGRNFSQADCERFGCGYAPQGWDNLVRHLASKGF
TQKEIFDAGLARQGQRGIYDYFRGRVTWPIRDSTGRTLGFGARKLYEDDQIAAKYINTPD
TQLYRKTQVLYGIDLAKSAIVKKRQVVIVEGYTDVMAMHLAGIDTAIATCGTAFGAEHAK
IVRRLIADDSLGAVQLVGPLKIKDQPLSSRIVFTFDGDAAGQKAALHAFGLDSAFLSQTF
VAVADNNLDPCDLRIERGNEAVRSLIANAKPLYDFVIDAAIGRFDLTYTPGQVGAMKAVA
PLVAQIRDRSLWDAYARKAAGRIGVDLEVMRREVMAARRQMHVRDEDAYAPKRRFDREER
RVEPGTNPYANPAARKTLERRDAAEQAYFKIDDAVFIAEQQFMATLIQVPRAIDRTMFGQ
LTIDHFMTSVFRTLFQVIAAAGGLPSDNTPQGLWMHNLTKAGGPMLNQVINELAVMPLPL
PGDDSGNGAQPVQPNAPGGAGAPGAAAMQLRPATAEEQRYATELLTRLLDMGFMRQIGLA
KRRMAQLPDGEEKITLLGQITRMETARKDLQAQIYGNTVG