Protein Info for BBR_RS13175 in Bifidobacterium breve UCC2003

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR01353: putative dGTPase" amino acids 34 to 427 (394 residues), 273.9 bits, see alignment E=1.6e-85 PF01966: HD" amino acids 71 to 124 (54 residues), 47.2 bits, see alignment 2.6e-16 PF13286: HD_assoc" amino acids 331 to 425 (95 residues), 58.6 bits, see alignment E=7.5e-20

Best Hits

Swiss-Prot: 95% identical to DGTL1_BIFLO: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (dgt) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 95% identity to blm:BLLJ_0465)

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>BBR_RS13175 deoxyguanosinetriphosphate triphosphohydrolase (Bifidobacterium breve UCC2003)
METTQDGERVLSDEGYSAFDEERWAPEPPKSKARTAFERDRARLIHSSALRRLGAKSQIL
IAGTDDFARTRLTHTLEVAQIGRQIGAMLGCDPDVVDCACLAHDLGHPPFGHNGERALAE
IARNIGGFEGNAQTMRILTRLEPKIFHPDGRSAGVNLTRAALDAAVKYPWTLAEADQHPK
GERSKKFCVYPDDEPVFRWLKIGAPVATKPMECQIMDLSDDIAYSVHDVEDSIATGAFDP
IVLADSQILDHIIEQTRGWYGTKWDADKLLAAFMRLRREHMFPAHFNGSRQALAQLKNIT
SDLIGRFCWSVETATRDTYGPGPLTRYSANIVIPEDTNYEIVALKGIAVYFVMAPREREP
FHQEELKIVEDLIDVLMADSPQPSDALESQFLADWNESTNDNERLRVAIDQVASLTDNSA
LALHSILC