Protein Info for BBR_RS13165 in Bifidobacterium breve UCC2003

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 308 to 333 (26 residues), see Phobius details amino acids 365 to 381 (17 residues), see Phobius details amino acids 387 to 406 (20 residues), see Phobius details amino acids 418 to 439 (22 residues), see Phobius details amino acids 445 to 462 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 25 to 442 (418 residues), 209.1 bits, see alignment E=1.8e-65 PF00324: AA_permease" amino acids 28 to 447 (420 residues), 153.3 bits, see alignment E=1.4e-48 PF13906: AA_permease_C" amino acids 417 to 467 (51 residues), 53.6 bits, see alignment 2.9e-18

Best Hits

Swiss-Prot: 56% identical to YHDG_BACSU: Uncharacterized amino acid permease YhdG (yhdG) from Bacillus subtilis (strain 168)

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 96% identity to blb:BBMN68_911)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>BBR_RS13165 amino acid permease (Bifidobacterium breve UCC2003)
MDLFRKKSVDQLVAESTPLKRTMRTFDLTMLGIGAIIGTGIFVLTGKGALTAGPALSVSF
LLAAVCCGFAGLCYAEFAAMAPVSGSAYSYAYLAFGELIAFVIGWDLILEYALQAATVSA
GWSGYFNKLLEGFGLHLPVELTAAYGTTPGVTTYFNLPGFVIVLIITWVLSIGINQTKRT
NDVMVLIKLAIIVLFIVCAVWYVKPSNWQPFSPYGIYTFQPGSTQPYGIVPAASIVFFSF
IGFDAVSSSAEETVNPNKTLPRGILLSLAISTVLYVIMTMIMTGVVPYKEFAKYIDAPVA
GVILETGMNWLAVIVNLGALIGMTTVMLVQLYGQSRICYAMSRDGLFPEFFGHVHEKYRT
PFKGTWFFGILTAIAGGFININVLFELVNIGTLSAFIIVSAGILWMRKTQPDAHRGFRAP
GVPVTPILAIVFCFILIAGLNWETWVRFAVWFGLGLVVYFGYSRKRSKLGLEDKAKAEAT
AAAKD