Protein Info for BBR_RS13125 in Bifidobacterium breve UCC2003
Annotation: ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 93% identity to blo:BL1159)Predicted SEED Role
"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-positive bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (297 amino acids)
>BBR_RS13125 ABC transporter permease (Bifidobacterium breve UCC2003) MPEGGQRAAFAIVLHSMWRRAEGKFALIVLASWLLIAIVSLFWTPQSLWATDGYYVWAKP SAAHWLGTDGTGADVFSWLLAGSHTNLLIVLLTVVVSATWGLLLIAAMVARNAALASSSV VVVDALISIPTVLIALILAVPLGASIVVIVIACGFGYGLNLARVARPVALLAARSSYVES ALANGASGWRVLVSHIVPNILPVLAVQLSLSAGTAVLAESGLTYLGIGVPSGVPSWGHSL ATSVKLINVFPLTVVWPGLIVTVVVVALNIFGDVLRDAIDPVANPALREAGEGGDER