Protein Info for BBR_RS13120 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 96 to 121 (26 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 75 (75 residues), 51.5 bits, see alignment E=1.1e-17 PF00528: BPD_transp_1" amino acids 112 to 315 (204 residues), 85.3 bits, see alignment E=4.6e-28

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 89% identity to blb:BBMN68_922)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>BBR_RS13120 ABC transporter permease (Bifidobacterium breve UCC2003)
MRFVLKRLALFVVALLGLSVVIFAALRILPGDVASVMAGVNSPPERVAQLREQLGLNRPL
VAQYFDWMGALIHGDFGTSILTGRSVTSLVGSRAAITFPLIILGMLIALVIGLPLGCAAV
LARSERVRSVFHVLAIIGGAIPALWGGLLLILLFGRGVGLIGVFPSQGFPLDGWGAPGSA
ILSLILPALSVGVIVGATIMRYTRSALDDLAGSGYIDMARSCGMTRTQAVLHVGLRLATP
QLVSVIGLTFASMITGVMVIENLFALPGIGNGLVTDVGNRDLIAVQSELFLLAAFFLLIG
LVVDLLHRVLDPRLKTVATITEVTA