Protein Info for BBR_RS13090 in Bifidobacterium breve UCC2003

Annotation: Permease of ABC transporter system for sugars

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 58 to 80 (23 residues), see Phobius details amino acids 100 to 114 (15 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 141 to 319 (179 residues), 57.9 bits, see alignment E=5.8e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 93% identity to blj:BLD_0927)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>BBR_RS13090 Permease of ABC transporter system for sugars (Bifidobacterium breve UCC2003)
MSAAASTRLTDAELKAREKAARKAEKERQKRIAADEAAERKRSARAGFANVNNPRRSTLM
TVLCAIFAVYCLFPFVYLVINATKTQADFTSTFGLGFGKSFALWDNIVTVFTYQGGIFGR
WLVNTLLYVVVGAGGATLLAIMGGYALAKFRFPGRKAVFAVIIGSISVPGIALAVPQFLL
FAKLGLTNTPWAMIIPSLISPFGLYLMWIFSEQAVPTELLEAARVDGASEFRTFWTISLP
LLAPGIVTTALFTIVATWNNYFLPLIMLKDADWYPLTIGLNQWKDQASTAGGQAIQNLVI
TGSLITIIPLVIAFLCLQKYWQSGLAAGAVKE