Protein Info for BBR_RS13085 in Bifidobacterium breve UCC2003

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 117 to 294 (178 residues), 47.8 bits, see alignment E=7.3e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 91% identity to blj:BLD_0929)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>BBR_RS13085 sugar ABC transporter permease (Bifidobacterium breve UCC2003)
MASADVAAVPMHTDKARENKHKADWRGWKFMWPFTVVFVFVFIIPIVYAVYISFFKKQMI
GGTRFVGVENYARLLQDGQFWSSVGRVALFTCVQVPIMLFLSAAMALALDSMKLHGAKFF
RISTFLPYAVPAVVSTLVWGFVYGAKYGLVGSFNDFFGTNVDVLQPGVLLASIGNISTWE
FTGYNMLIFYSSLSTIPHSLYEAASIDGASEWQIVKSIKLPELKGSLAITVIFSIIGSFQ
LFNEPSILQNMVPGNAITTYYTPNMYAYNLSFSGNQSNYAAALAIVMAVITMAIAYAVQL
KSMKEQMK