Protein Info for BBR_RS13080 in Bifidobacterium breve UCC2003

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF00356: LacI" amino acids 1 to 45 (45 residues), 67.7 bits, see alignment 1.2e-22 PF13407: Peripla_BP_4" amino acids 73 to 269 (197 residues), 51 bits, see alignment E=3.1e-17 PF00532: Peripla_BP_1" amino acids 75 to 306 (232 residues), 78.3 bits, see alignment E=1.4e-25 PF13377: Peripla_BP_3" amino acids 165 to 324 (160 residues), 99.2 bits, see alignment E=5.8e-32

Best Hits

KEGG orthology group: None (inferred from 90% identity to blo:BL1171)

Predicted SEED Role

"probable LacI-type transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>BBR_RS13080 LacI family DNA-binding transcriptional regulator (Bifidobacterium breve UCC2003)
MQDVAKAAGVSPQTVSRVANDSNAVKPETRQRVEAAMERLGYRPNYAARALKHGRFQDIG
VVMFDTTRFGNARILDSIVTHAAEDGYSVTIQTMSNGAERTLASAIDRMQRQPVDGVIVV
LEERISDFVGYKPPRELPVVLISEAAADHCPTVDADQYGCSTAIVDYLMSKGHKTVYHIA
GPVTSRAAESRAQGWREALEQIGARVPSMYIGDWCADSGYQAGVALAHDPECTAIYAAND
QMAYGAMLGLESAGKRVPEDVSIVGVDDSLVDVVPRLNLTTMRMRNDAIGATAFSMVRRQ
CEGEKVPAGIKTVIPTELIKRGSVRDIS