Protein Info for BBR_RS13070 in Bifidobacterium breve UCC2003

Annotation: glutamine--fructose-6-phosphate transaminase (isomerizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 TIGR01135: glutamine-fructose-6-phosphate transaminase (isomerizing)" amino acids 2 to 630 (629 residues), 731.4 bits, see alignment E=4.1e-224 PF13522: GATase_6" amino acids 74 to 202 (129 residues), 65 bits, see alignment E=1.1e-21 PF13537: GATase_7" amino acids 90 to 212 (123 residues), 42.3 bits, see alignment E=1.1e-14 PF01380: SIS" amino acids 310 to 431 (122 residues), 107.9 bits, see alignment E=5.1e-35 amino acids 480 to 610 (131 residues), 64.9 bits, see alignment E=9.7e-22

Best Hits

Swiss-Prot: 62% identical to GLMS_COREF: Glutamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS) from Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)

KEGG orthology group: K00820, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC: 2.6.1.16] (inferred from 98% identity to bln:Blon_2018)

Predicted SEED Role

"Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.6.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>BBR_RS13070 glutamine--fructose-6-phosphate transaminase (isomerizing) (Bifidobacterium breve UCC2003)
MCGIVGYAGNVETACGKPLEVCLQGLERLEYRGYDSAGVALTASGMDKVTVRKKAGRLKN
LVEDIECKPMPLATVGIGHTRWATNGEPSDVNAHPHTSMDGKVAIIHNGIIENASQLRLD
LQAEGYRFASATDTEVAAKLLGKIVDKIIAEEGKPNLFKAVRRMARMLEGAFTILATDCR
QPDIVVGARHDSPLVVGLGDGENFLGSDVAAFVAYTKRAMEVDQDQAVCVSADKVIVTDF
DGNVIENPKTYTVDWDASAAEKGGWDSFMDKEIHEDPAAVQRTLLGRFDPNGDITLDEVR
IDQHDFKAIDKIIVVACGTASYAGQVAKYAIEHWVRIPVEIELAHEFRYRDPILTPRTLV
VAISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPRESDAVLYTHAGPEVAVASTKA
FVAQITAAYLLGLYLAQVKGAMFRDEIHQVLDSLKDMPRKIQWVLDTQPKTIQAAAERMV
NANSFLFLGRHVGYPVALEGALKLKEIAYTFTEGFAAGELKHGPIALVDEGEPVVFIVPP
ERGRNVLHAKVISGIEEVKARGAYIIAVAEQGDPDVERYADVVFWRPACPTLMSPLVDVV
PLQLFAMDMAKLKGYDVDKPRNLAKSVTVE