Protein Info for BBR_RS13060 in Bifidobacterium breve UCC2003

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 104 to 132 (29 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 63 to 178 (116 residues), 47.6 bits, see alignment E=9.5e-17 PF00528: BPD_transp_1" amino acids 83 to 280 (198 residues), 51.6 bits, see alignment E=5.1e-18

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to blm:BLLJ_0435)

Predicted SEED Role

"ABC-type amino acid transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>BBR_RS13060 amino acid ABC transporter permease (Bifidobacterium breve UCC2003)
MAKKEVDGEGLNIPNRIKALPVKRPGPIVAAVIVVLLAAMLIQGMITNPRLDWPTVWKYL
FNENVLEGIQYTLTLTVISMVVAIILSVILAIMRKSINPVLRGVSWFFIWFFRGTPVYTQ
LIFWGLFAVLIPKISLGIPFTSVKFWSIDSNVVVTAFNAAWIGLALNEAAYLSEIVRAGL
EAVDPGQTEAAKALGMNRTLIMRRIVLPQAMRIIIPPTGNETIGMLKTTSLVTAVPFTLE
LQFATNAIANRIYKPIPLLIVACFWYLLITSILMVCQSRLEAHFGKGFDARPVGTKGKQA
PLPGKTDGEPKDDVDKLNQTTFVGLNA