Protein Info for BBR_RS13055 in Bifidobacterium breve UCC2003

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00497: SBP_bac_3" amino acids 74 to 297 (224 residues), 169.5 bits, see alignment E=4e-54

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 94% identity to blo:BL1178)

Predicted SEED Role

"probable solute binding protein of ABC transporter system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>BBR_RS13055 ABC transporter substrate-binding protein (Bifidobacterium breve UCC2003)
MQSTKLKSMMAMALSSAMLFATAACGTSDKADAGTDSAKGSDAATITSYDVSSVKKDDAI
AALLPESVTKDGKLTIGTNPSYAPAEFLDADGKTQIGYDMDLARALGNIFGLDTEIVSSN
FDTIIPAIGTKYDLGIAAFTITKERMQSVDFVSYFTAGMGYAVAKGNPKNVNPDDLCGLN
VAVETGTVEEDAINETAKQCKADGKKDITIQSSKQQTDATTAVVTGKADVFFADSPVVGY
AIAQTEGQLEQLGKDFDSVPNAIAIKKGDSQTTDAVQKAMQKLMDDGTYGKILQHWGVES
GALDKAEINPSVD