Protein Info for BBR_RS13035 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 181 to 203 (23 residues), see Phobius details amino acids 237 to 262 (26 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details PF18075: FtsX_ECD" amino acids 56 to 164 (109 residues), 42 bits, see alignment E=1.2e-14 PF02687: FtsX" amino acids 187 to 303 (117 residues), 46.9 bits, see alignment E=2.6e-16

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 92% identity to blj:BLD_0940)

Predicted SEED Role

"FtsX-like protein involved in cell division"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>BBR_RS13035 ABC transporter permease (Bifidobacterium breve UCC2003)
MRMRFILSETGTNLRRNLSMLLSLMLVTFISFLFIGASVLTQAQITKAKGDWYDKVEVVV
WLCPDGTSQSANCASGKSPSAAEITALQKTIRDELNDVVSNINYVSKQDFYNNTFTKQYP
NGEFQGRTLTADDMQDSLWLKLKDPTKYQVVAEVLSSKEGVEDVTDQRQIFDPVFAILNR
ATAVTAVLAGVMVLVAILLTGTTIRMSAASRRTETEIMRYVGASNWTIRLPFILEGAIAS
GIGSILSCVMLSVIVHVFITGWLAQSVTWIPYVNQMTVLLISPFLVVGAVLLSVIASTIS
LRRYLRA