Protein Info for BBR_RS13030 in Bifidobacterium breve UCC2003

Annotation: cell division ATP-binding protein FtsE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR02673: cell division ATP-binding protein FtsE" amino acids 3 to 216 (214 residues), 273 bits, see alignment E=8.8e-86 PF00005: ABC_tran" amino acids 21 to 168 (148 residues), 128.1 bits, see alignment E=6e-41

Best Hits

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 83% identity to blj:BLD_0941)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>BBR_RS13030 cell division ATP-binding protein FtsE (Bifidobacterium breve UCC2003)
MALIALDDVSKIYPKGTRPALDGINLSIERGDFVFLVGASGSGKTTLLSLLLREEEATSG
EIRVAGNDLRRIANRQVPHYRRTLGFVFQDYKLLNNKTVWENVAFALEVIGTRRSTIKSL
VPKVLDTVGLTGKEKNYPHELSGGEQQRVAIARAYVNHPQILLADEPTGNLDPTTSLGIM
EVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHGGKIVRDEAHGSYDSALYFPDAEAEA
KFGRANHIPDARTNAIAAPEEGEPSEGIARLANSVHSGRTGRYGETFAPLEDTLTWGKGL
ALDEQAASLEATQAFDSLHPEESVSSTTVEVSETLAVPETSVAGEIPEQQSVGDGEGTNQ
AEPSSVQADEVPMPPAPPAPPAPPSAESQSATSEGKEE