Protein Info for BBR_RS12985 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 348 (314 residues), 48 bits, see alignment E=4.3e-17 amino acids 293 to 427 (135 residues), 34.4 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: None (inferred from 93% identity to blb:BBMN68_958)

Predicted SEED Role

"possible transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>BBR_RS12985 MFS transporter (Bifidobacterium breve UCC2003)
MSTARAVSKSSATHSPYQRLFSLPGTKAFCISGAVARLPISMMSLGIVLALNHLYDNWTI
AGTMSAAYVLAMSCVTPFYARAFDRFGQARVGRLALAVQIVAMLAFAFAALIRVPIPLLF
VLAIIMGLTQFSFGALVRTRWSYALRGAEDGEQLLNTAYAMEAAIDEIVFILGPILAAWL
ATSVHPVSQLFVPTMACGIGGTVFFSLRSTQPPVIVEQVTVAAADNGHPTPSDDADQLTL
RQLKRSGAKPKSVLLYAGVLPLLAVFIVFNMSFTSFDVSITATMKSMGLEPFLGLQLAMF
AVGSCIGALVFGSRKIKGSHWAHMVMFLSLLTVGYVFFRLTMDNLILLGAMEILSGLVVS
PTFATGNLIVKDLVPPESLTEGLSWVTTAGTVGTSIGSSVAGIVLDASSPHAGMMLPFLF
TLASVPLALAGWALAKRRV