Protein Info for BBR_RS12955 in Bifidobacterium breve UCC2003

Annotation: transglutaminase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 624 to 645 (22 residues), see Phobius details PF01841: Transglut_core" amino acids 415 to 546 (132 residues), 53.6 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: None (inferred from 65% identity to blf:BLIF_0427)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (809 amino acids)

>BBR_RS12955 transglutaminase domain-containing protein (Bifidobacterium breve UCC2003)
MIARQSKKQQGISLAAIALMMVLAQSNLIDVYADHMMWIAAAIPSTALGTAIAFAGTRYS
LTIWWQLTFLTLTQFIIGPVIALPSTTIAHVIPSLDTLSQGWEMTFGAFKYLISVAPPVG
TAYGSLMAVWTIGLWLAFLAGTFAISDHAWTSAIAAIPLATAMTVCALLGTSHGWHRTLC
GITFAVLLIIWMAWRLEFMEWERWFCALVVVTLAAGLAVGGSALASPHRLILRDTYNPPL
SPYDYTSPLSSMRSYIKDHRDDTLLTITNLPAGTPVRLAVMDWFDGSVWNLSDSSKASDC
ANYQRVGTTISTDERGMAFTATFTVHRGLADVWLPLAGAATGVQFLGKDENSPFYYNRDT
NSAILPSGTSEGLTYIESGIIADTPTDQQISTAKAANISQPKALDVPNAVSTLASAAAGG
QSRGGAAAQDLAAMLRSSGWFSHGLQNDYPSAAGHGNYRVNALLTGTTMVGDSEQYASAM
ALMARELGLSSRVVLGFLPKDEDGDITNARGKKTSGSGTEITFTGDDITAWVEIKLRNLG
WVAFYPTPKESKIPDDSQSSAPPDPKNLVRQPPVPFIDPLRDQTQVRGQSALSGTDAEVA
SSDESFWLQFHRAARTAAIYSSPLWITLTVCVLILAFKALMIALAQRRGSPRTRIAAGWN
ALRTLAVQSGGIPLSGTRRNQAHAIAHQFGIANQALQQLGREADYATFSGRNITPAQSTQ
YWTSVKRLRTAMLRSMPRLKRFRTQLSLRGVTVRIPRQSRSPSRAEILKTGSAGRIHRTS
STSRPSRANRDNRHQYQPQNTRPADPSRK