Protein Info for BBR_RS12935 in Bifidobacterium breve UCC2003

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00730: HhH-GPD" amino acids 35 to 153 (119 residues), 61 bits, see alignment E=2e-20 PF00633: HHH" amino acids 100 to 128 (29 residues), 33.7 bits, see alignment (E = 3.1e-12) PF10576: EndIII_4Fe-2S" amino acids 218 to 234 (17 residues), 26.3 bits, see alignment (E = 1e-09)

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 96% identity to bln:Blon_2051)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>BBR_RS12935 A/G-specific adenine glycosylase (Bifidobacterium breve UCC2003)
MNDTAISLRLGAWWEANARDLPWRFGRATPWGVLVSEVMSQQTQMSRVVPYWNDWMARWP
DARALAAAPKADVITAWGRLGYPRRALRLQECARVVAEEYGDELPRTYDELVALPGIGDY
TASAVLSFAFGERIAVIDTNIRRVLSRVFLGTESRGGAASPAERALANRMLPQDRVCGDG
ADCTDHAYRSGEHTFLQRSEPPSVTWNQSVMELGAVVCTAKTPLCEICPIADDCAFLKAG
RPGLGERRTRPRQRFQGTDRQVRGLVLAALRALPANDTLARVDAENLWKDQIQLDSCIAS
LDDDGLIEILENGALRLPHD