Protein Info for BBR_RS12915 in Bifidobacterium breve UCC2003

Updated annotation (from data): glycine synthesis protein GlyXS
Rationale: Important when glycine is not available. A homolog from Methanococcus has similar phenotypes, so this appears to be part of a novel route to glycine, along with GlyXS (BBR_RS12920). Also has milder phenotypes on Irgasan and Clotrimazole which are not explained.
Original annotation: ACT domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF13740: ACT_6" amino acids 5 to 78 (74 residues), 47.6 bits, see alignment E=1.3e-16 PF01842: ACT" amino acids 5 to 68 (64 residues), 41.4 bits, see alignment E=9.8e-15

Best Hits

Swiss-Prot: 99% identical to YC0A_BIFLO: UPF0237 protein BL1209.1 (BL1209.1) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K07166, ACT domain-containing protein (inferred from 99% identity to bln:Blon_2055)

Predicted SEED Role

"ACT domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (90 amino acids)

>BBR_RS12915 glycine synthesis protein GlyXS (Bifidobacterium breve UCC2003)
MNKAIITVVGQDTVGIIARVCTYLSEHNVNVLDISQTIIDGYFNMMMIVDYANADKDFGA
MVGNLEDLGDDIGVRIRCQREEIFTKMHRI