Protein Info for BBR_RS12900 in Bifidobacterium breve UCC2003

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF01047: MarR" amino acids 4 to 53 (50 residues), 28.9 bits, see alignment 2.2e-10 PF00392: GntR" amino acids 6 to 57 (52 residues), 27.2 bits, see alignment E=6e-10 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 32.6 bits, see alignment 1.5e-11 PF08220: HTH_DeoR" amino acids 6 to 60 (55 residues), 62 bits, see alignment E=9.1e-21 PF00455: DeoRC" amino acids 79 to 236 (158 residues), 127.9 bits, see alignment E=9e-41

Best Hits

Swiss-Prot: 30% identical to AGAR_ECOLI: Putative aga operon transcriptional repressor (agaR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to bln:Blon_2064)

Predicted SEED Role

"probable DeoR-type transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>BBR_RS12900 DeoR/GlpR transcriptional regulator (Bifidobacterium breve UCC2003)
MISSQRQHLILSRLRTRGAVRITALSKELGVSAMTIRRDIAELADKGLLKRVHGGAVTTS
TLLSEPLFSVKSQMDIGLKDAIAQEAIKYVAPGDVIAIGGGTTAYVFAQHLLESQQSSGI
TILTNSIPVAELVQALESKDVEVIVTGGVITRSNSLVGPIADKVVASLRVNTVFLGTHSV
SIPRGFLMPNSLEAATDMAMMDIADRTIVLTDHTKWSCTSLSLFARFDQVDTVITDDGLD
PDSAAKTKDLVKELVLAHQSETIEESE