Protein Info for BBR_RS12880 in Bifidobacterium breve UCC2003

Annotation: Crp/Fnr family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00027: cNMP_binding" amino acids 42 to 117 (76 residues), 67.7 bits, see alignment E=1.1e-22 PF13545: HTH_Crp_2" amino acids 162 to 234 (73 residues), 59.8 bits, see alignment E=3.1e-20

Best Hits

Swiss-Prot: 44% identical to CRPL_CORGL: CRP-like cAMP-activated global transcriptional regulator (glxR) from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

KEGG orthology group: None (inferred from 94% identity to blj:BLD_0979)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>BBR_RS12880 Crp/Fnr family transcriptional regulator (Bifidobacterium breve UCC2003)
MSLETPNAFADEENILLHTALFKQVSPSEAEELLPYLKHAAYDKGDYIFSEGDTDHRMYL
LERGRVKLVRTSSDDRVQLLSIHAPGEVLGEIPVFDPNGGPRTASAVAMSHGTCVVWLEH
DTLFSWLDEHPRVAIDMLQVMANRQRDNNERISDLVFMDVPARLAKTLLNLGSRFGEPVE
QGLKVPHDLTQEELAQLVGSSRETVNKALMDFSNRGWIARDGRSIIIFQPGMLIRRSRR