Protein Info for BBR_RS12875 in Bifidobacterium breve UCC2003

Annotation: lipoate--protein ligase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF03099: BPL_LplA_LipB" amino acids 205 to 307 (103 residues), 29.3 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: K03800, lipoate-protein ligase A [EC: 2.7.7.63] (inferred from 76% identity to bll:BLJ_0447)

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>BBR_RS12875 lipoate--protein ligase A (Bifidobacterium breve UCC2003)
MHMRHGECKTPGGKLVAVNVAVDEDGTIKSCHISGDFFIEPDVTTSTRFAGAPASGGEAS
EALIHDLEQALVRGGSLQSVLDVHSDCRLIGTDASAIETAFLRAISSELTPPPAGDPAKR
VGVSGTDTTGTSASVDTQYGQTDKTAEYQSRWNELKRNLTVIRDHPRTPAEQMAIDETWA
REVAAGTRPPTIRFWEWAGAAVVIGKFQSAPDEVHLAVAEQLGFSVVRRCTGGGAMFIEP
GNTITYSLYAPLDFVHGISIEESYRLCDWWLVEALRGLGLDVRFAGLNDIASQYGKIGGA
AQRRFPGTGNAGESGAVLHHVTMAYDIDAAKMVRVLNTSQEKLSDKAVRSAVKRVDPMKS
QTGLTREQIIDDLLAWFTPAQFRGDAS