Protein Info for BBR_RS12855 in Bifidobacterium breve UCC2003

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 13 to 132 (120 residues), 130.7 bits, E=1.7e-42
• PF01597: GCV_H
  • amino acids 17 to 132 (116 residues), 123.1 bits, E=6.3e-40
• PF00364: Biotin_lipoyl
  • amino acids 55 to 103 (49 residues), 28.9 bits, E=8.3e-11

Best Hits

Swiss-Prot: 90% identical to GCSH_BIFLO: Glycine cleavage system H protein (gcvH) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 90% identity to blf:BLIF_0405)

MetaCyc: 41% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (2/3 steps found)
• glycine cleavage (2/3 steps found)

Protein Sequence (133 amino acids)

>BBR_RS12855 glycine cleavage system protein H (Bifidobacterium breve UCC2003)
MSDETEQPLNLDIPEHLEYSDEHVWVDRSDDLAIIGITEYAADQLGELVFVDLPEPGTRV
EAGDEIVELESSKAVQPLISPVAGTVKYVNRDVADDPSVVNGDPYGEGWILKVELDDDEP
ELLTAEEYAKIIR