Protein Info for BBR_RS12845 in Bifidobacterium breve UCC2003

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF00561: Abhydrolase_1" amino acids 17 to 134 (118 residues), 37 bits, see alignment E=6.1e-13 amino acids 198 to 264 (67 residues), 27.4 bits, see alignment E=5.2e-10 PF12697: Abhydrolase_6" amino acids 18 to 270 (253 residues), 70.8 bits, see alignment E=5.5e-23 PF12146: Hydrolase_4" amino acids 50 to 257 (208 residues), 41.6 bits, see alignment E=1.9e-14 PF03096: Ndr" amino acids 65 to 276 (212 residues), 32.1 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to blf:BLIF_0403)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>BBR_RS12845 alpha/beta hydrolase (Bifidobacterium breve UCC2003)
MAIELANHIYRDGEGVPVVLMNAYPVDHRMWDVCAKALADFADLEDVPPFPIWAPDMAGS
GESPVPSEADSGPRMANGAYSEALDRLADAYVDLIKAAGYEQAIWVGLSMGGYVAMDIQR
RHPEAAAGLALCDTMAASDGVGGEGRLTMANAAEQTNSVEPVMHFARPAEGDSTVKRTPE
FIETMTAWIEEQNPAGLAWRQRMTYGRPDMSDVPATISVPTVVVSGEQDPSSNPSVLKPL
AEKIAGAEFVDIPDCGHFSAVEHPDTVARALLSLVKRVQQH