Protein Info for BBR_RS12835 in Bifidobacterium breve UCC2003

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF00085: Thioredoxin" amino acids 4 to 103 (100 residues), 97.1 bits, see alignment E=1.1e-31 TIGR01068: thioredoxin" amino acids 7 to 104 (98 residues), 107.4 bits, see alignment E=1.8e-35 PF13098: Thioredoxin_2" amino acids 17 to 101 (85 residues), 27.8 bits, see alignment E=5.4e-10 PF04756: OST3_OST6" amino acids 30 to 82 (53 residues), 27.1 bits, see alignment E=5.5e-10

Best Hits

Swiss-Prot: 45% identical to THIO2_STRCO: Putative thioredoxin 2 (trxC) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: None (inferred from 99% identity to blf:BLIF_0401)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>BBR_RS12835 thioredoxin (Bifidobacterium breve UCC2003)
MATTAITSAEFEKTITDNEIVFVDFWATWCGPCRAFGPIFEAASNEPENANIAFVKVDID
ANQDLAQAAGIQAVPTLMIAKQGEVIFQQAGALQASDLDDLIAQAKALDLAAAKAQQAAQ
EQQ