Protein Info for BBR_RS12830 in Bifidobacterium breve UCC2003

Annotation: G5 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF03990: DUF348" amino acids 79 to 122 (44 residues), 26.5 bits, see alignment 4.3e-10 PF07501: G5" amino acids 139 to 211 (73 residues), 59.4 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: None (inferred from 98% identity to blo:BL1227)

Predicted SEED Role

"FIG00672571: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>BBR_RS12830 G5 domain-containing protein (Bifidobacterium breve UCC2003)
MSKHAERTSFVKTLSRGQWAKIAAAAAAVGLIATAGVISRDFYQSSTATPSITPTSFSAT
DGAASRSASRGALKSTTYVTVKVNGKSRVVLGEKASMTTVKDVLETGDIVLDPEDSVTPS
LDSKVSESTVISINRANTTVETTDTEIAFNEVRKETSSLPKGQEKVETEGEKGVLETTSL
VTRSGDQVVSSNVFTSWVKKAPVDKVILVGTSAVSSPSAASLGTTTPAGEIQSWAHDYLI
SNGYSEADFTAANFIISHESGWSPTATNPSSGAYGLPQALPGSKMASAGADWQTNYQTQF
KWFVNYCNGRYGSISGAYAYWQKHKSY