Protein Info for BBR_RS12810 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 236 to 265 (30 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 386 to 411 (26 residues), see Phobius details amino acids 422 to 448 (27 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 98% identity to bln:Blon_2083)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (463 amino acids)

>BBR_RS12810 hypothetical protein (Bifidobacterium breve UCC2003)
MSTPNNTQLGNKSVQEKRRNSGHCPALQRGAMTETLTRITITPSDMLMFAAVAMLPFDGT
KIGIPLPYWTPISPWLFTLYTIINWRYLRDTARRFLPFFLFPLLLVLTSVYGWQSYGIHA
SATAKSFISILLGLACLASLDIAIRIKRVPVRTLLTTLFTAYVVAFLIGILQYIALERHL
NWQPVRAYFWGALYRNYASVRPQFMFAEPSYIGMHLFGVLLPVFWLTRNRKIGILIPIFA
AGAIAMGSGTRIILDTVVATFIWLIATINFHSRKVTAGFVGALGLLGAGGLSAIIINPRL
SSLATNGLLAGDGSMSARIFHMLAPMWSWKHDLSHFMFGWGAGNISNAVRTGYAGARQWY
DAHGGAPNTEIDGLANPPADTFTMSIYASFITEFGLFCFLAFLLLVLAHVAVHHGWSRRN
ICWFILLAYLYIQFESYAFYAIPLFIWAVCTIMNQGKNNINSL