Protein Info for BBR_RS12665 in Bifidobacterium breve UCC2003

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 119 to 145 (27 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 244 to 270 (27 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 333 (321 residues), 85.5 bits, see alignment E=1.9e-28

Best Hits

KEGG orthology group: None (inferred from 96% identity to bad:BAD_1379)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>BBR_RS12665 acyltransferase (Bifidobacterium breve UCC2003)
MSYEPDRSKSRIIWVDIARAVAMVLVFTGHLGASWFPQLEPLLTAIYTFHMPLFFLLSGL
FFKPTVNLLNLIIKRAKTLLIPYYLFSVFALVSPIVKLLRPSLYESAGKSADSNPLSAII
AIVFAQGNAGLWFLWSLFVAIPCLWLTVRVVRSNKLVLAAVLLVYLIIDFFLKGTSVVAM
LPFQLGKIFEATAYVGFGYLIAQACDIRKWDRLNFSHKLGAFLVFTVAFLILEHFFASQP
VATGAMLATLALFTTFFGMAMAIAFSLLLPEARCFATIGRDSLVFYALNDLALKMVKFVL
FSAVGIPVASLPLGGQLLVGFLTIIVAIAVCYVLDIFIQHHMRWAIGDFGSVRHA