Protein Info for BBR_RS12660 in Bifidobacterium breve UCC2003

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 151 (32 residues), see Phobius details amino acids 164 to 192 (29 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details PF14897: EpsG" amino acids 28 to 350 (323 residues), 195.5 bits, see alignment E=6.8e-62

Best Hits

KEGG orthology group: None (inferred from 88% identity to bad:BAD_1380)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>BBR_RS12660 EpsG family protein (Bifidobacterium breve UCC2003)
MFVYITTVFCCILLMYVADKLNKRARILPFVITFLILFTISGFRYGVGTDYFFTYVPTYK
QIYNGTPPPMEPIFKWLNGLCIDFAGSWYQSIFIVTSFIFIGLIYIVIYNMPCSKVLLTV
SFLCGGYFLFSFNVVRQTIATALFCCALLFVERNMEGKKRLQSLFVAFSLIAIAVGFHYS
ALIYFVVIALLYLKLDKKIYLFFFFASAVLVPTFVAVIGILLKGTKYGNYISGYYADPSK
AFSLSSLLFVGFFFVYLFTDSKEDNHWFNIFRNLHFVGSIAIVIGFSIPLGQRVSALFYV
LNFLSIPYYLEYYITEKNKIFVKILYFSFCFFMFLHALAVNGNGVLPYNFAI