Protein Info for BBR_RS12635 in Bifidobacterium breve UCC2003

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details PF01943: Polysacc_synt" amino acids 8 to 262 (255 residues), 57.4 bits, see alignment E=2.5e-19 PF13440: Polysacc_synt_3" amino acids 36 to 269 (234 residues), 25 bits, see alignment E=1.7e-09 PF14667: Polysacc_synt_C" amino acids 328 to 454 (127 residues), 35.4 bits, see alignment E=1.7e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to bad:BAD_1386)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>BBR_RS12635 polysaccharide biosynthesis protein (Bifidobacterium breve UCC2003)
MGKYKNLLVNVGIFGLSAVATKLMAFILMPLYTLYLSTEEYGIMDMATIMVTTLFPVLTL
LISEGMLRFTLDDKSKAAFYITETMLVMLASCVLLAILLPVFDLPIFGGLGRYKIWFLLS
YAALCFPSVMGTVARAMDQMKLIAYASILSALIMGVLAYALIAGMNLGLMGYFYSYIVGN
GSAILVYLFAGKQYQFIDFTVWRNNASLRKQLWRYSLPLAPNSLCNQIQTTVSRFIITGV
LGISASGLYAAASKIPNLLNVLQQIVQQAWQLSAFQEFKSSGLKHFYDVIWRVYHALMSI
GSALVIALSPFIAKVLMQRQFYSVWPLISILVLAFYLGAINNFLGTIYQAYMRTKPLLIA
TIVGTVSCLAFTAMFVHSWGILAAALGVLVGSLTIFVIRVIDIRRLMRVDMRPFPTAITM
GLLAAQSVVTLIQCDHYLSLSLICLLSIAGAQCYELKPLINLMFGRRKYTA